PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01393.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28975.4 Da    PI: 9.375
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01393.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.72.3e-26959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++ rqvtfskRr+g+lKK +ELSvLC+a++ +iifsstgkl  y++
  Jcr4S01393.20  9 KRIENQTTRQVTFSKRRAGLLKKTHELSVLCEAQIGLIIFSSTGKLCQYCT 59
                   79***********************************************96 PP

2K-box67.83.7e-2371169197
          K-box   1 yqkssgks..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                    yqk +g+s   +++  e+l+ ela L+ke+  Lq ++  + Ged++s+s+++L +Leq+Le+s+ kiR++Knell +q+++l+kke++l+een ++
  Jcr4S01393.20  71 YQKLRGNSipEHDSLREHLYGELAMLRKETCRLQLNLQLYRGEDMSSISFEDLGELEQKLESSVAKIRNRKNELLQQQLDNLRKKERMLEEENGNI 166
                    6777788877788889*****************************************************************************988 PP

          K-box  95 rkk 97 
                     + 
  Jcr4S01393.20 167 YRW 169
                    765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.73161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002655.09E-39278No hitNo description
SuperFamilySSF554554.06E-30279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-263859IPR002100Transcription factor, MADS-box
PfamPF014866.8E-2185170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.32486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGKIPIKR IENQTTRQVT FSKRRAGLLK KTHELSVLCE AQIGLIIFSS TGKLCQYCTE  60
PFRMKQIIER YQKLRGNSIP EHDSLREHLY GELAMLRKET CRLQLNLQLY RGEDMSSISF  120
EDLGELEQKL ESSVAKIRNR KNELLQQQLD NLRKKERMLE EENGNIYRWI QDQRVAMEYH  180
QVTIEAKPAE HQQVLEQFPF CGEPSSLLQL AIIPSQIQSY HLQLAQPSSR TISSLLSPTF  240
KVLASSTSKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-17171169Myocyte-specific enhancer factor 2B
1tqe_Q4e-17171169Myocyte-specific enhancer factor 2B
1tqe_R4e-17171169Myocyte-specific enhancer factor 2B
1tqe_S4e-17171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072832.11e-168PREDICTED: protein TRANSPARENT TESTA 16-like
SwissprotQ8RYD94e-87TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLA0A067KMZ91e-168A0A067KMZ9_JATCU; Uncharacterized protein
STRINGPOPTR_0007s07620.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49352952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.22e-88MIKC_MADS family protein